Synonyms         GH1, GH, GHN, GH-N, hGH-N,Pituitary growth hormone, Growth hormone 1, Somatotropin. 

Type           Polyclonal Rabbit Antibody. 

Introduction          GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. 

Purity          Greater than 98%. 

Immunogen          IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants. 

Antigen Amino Acid Sequence          FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSKDTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF 

Purification Method            Purified IgG prepared by affinity chromatography on protein G. 

Protein formulation              Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline. 

Solubility                  Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely. 

Stability/Storage           Store at -20°C. For long term storage freezes in working aliquots at -20°C.

Repeated freezing and thawing is not recommended. 

Applications            ELISA: to detect HGH by indirect ELISA, a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng/well of HGH.

Western Blot: to detect HGH by WB analysis this antibody can be used in a dilution of 1/1,500. 

Usage                   CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.