Synonyms        Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a. 

Type          Polyclonal Rabbit Antibody. 

Introduction          IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase. 

Purity          Greater than 98%. 

Immunogen IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants. 

Antigen Amino Acid Sequence           CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ

IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR

ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE 

Purification Method          Purified IgG prepared by affinity chromatography on protein G. 

Protein formulation            Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline. 

Solubility              Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely. 

Stability/Storage            Store at -20°C. For long term storage freezes in working aliquots at -20°C.

Repeated freezing and thawing is not recommended. 

Applications             ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a.

Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,500. 

Usage              CHI's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.